IGF-1 LR3 1mg Peptide | Atomix Research
$59.99
Order IGF-1 LR3 1mg peptide from Atomix Research. Lab-tested quality with COA available. Designed for controlled scientific and laboratory research use only.
Description
Research use only
IGF-1 LR3 is a potent synthetic analog of insulin-like growth factor 1, featuring an arginine substitution at position three and an additional 13 amino acids at the N-terminus. These modifications make it significantly more potent and longer-lasting than native IGF-1, enhancing its effectiveness in stimulating cell growth, muscle repair, and metabolic activity. Researchers use IGF-1 LR3 in studies of tissue regeneration, lean mass development, fat metabolism, and endocrine signaling. Atomix Research supplies it in high purity, ensuring consistent and reliable performance in advanced laboratory settings.
Supplied in a sealed sterile vial to maintain maximum stability and purity. Store in a cool, dry place away from direct sunlight and moisture. Recommended storage temperature is 2–8°C for long-term preservation. After reconstitution, keep refrigerated at 2–8°C and avoid repeated freeze-thaw cycles. Proper handling ensures optimal stability for research applications.
For laboratory research use only. Products are not for human consumption. Atomix Research is a chemical supplier and not a compounding pharmacy. All products are sold for research, laboratory, or analytical purposes only. You must be over 21 to purchase from this site.
| Synonyms | Long R3-IGF-1, LR3-IGF-1, Long arginine 3 IGF-1 |
| Molecular Formula | C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉ |
| Molecular Weight | ~9117.5 g/mol |
| CAS Number | 946870-92-4 |
| Amino Acid Sequence | MFPAMPLSSL FVNGPRTLCGA ELVDALQFVC GDRGFYFNKPT GYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Appearance | White Lyophilized Powder |
